PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA9709
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 341aa    MW: 38085.1 Da    PI: 6.8617
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA9709genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.9e-343690155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Tp57577_TGAC_v2_mRNA9709 36 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 90
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8013393IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-323391IPR009057Homeodomain-like
SuperFamilySSF466891.63E-163591IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-233691IPR006447Myb domain, plants
PfamPF002492.4E-83888IPR001005SANT/Myb domain
PfamPF143792.3E-21129167IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MERMFPAKKP STMMNSHDRS MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVAQLGGPD  60
KATPKTIMRV MGVKGLTLYH LKSHLQKFRL GKQPHKEFNE QSIKDVSAFE LQRNSGNSSS  120
MTGRNMNEMQ MEVHRRLHEQ LEVQKHLQLR IEAQGKYMQN ILEKAYNTLA GENMAAASAT  180
NFKGIGTQGI PNMKDFVSPL NNFPHFQDLN ICGSDDEQLE RPTIDGFMPN ISNENLFVEK  240
KITNNPFNGS GKGPLIWNDN NDLRLHDLGT TSSCISPQDV PNFKGDDDSL DRGDIESDPI  300
VEINYDTKLS EKKFDASMKL GITTPMINAV AAGRSSSPFS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0526380.0BT052638.1 Medicago truncatula clone MTYFD_FE_FF_FG1G-O-4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514445.10.0PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK51e-103APL_ARATH; Myb family transcription factor APL
TrEMBLB7FKL90.0B7FKL9_MEDTR; Putative uncharacterized protein
STRINGGLYMA15G29620.11e-156(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-104G2-like family protein